PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6KG134800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YB
Protein Properties Length: 281aa    MW: 30012.2 Da    PI: 10.6836
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6KG134800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1825.1e-57156252197
                NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 
                          vreqdrflPian+srimkk++Pan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplkvyl+ky
  Pavir.6KG134800.1.p 156 VREQDRFLPIANISRIMKKAIPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKVYLQKY 245
                          69**************************************************************************************** PP

                NF-YB  91 relegek 97 
                          re+ +++
  Pavir.6KG134800.1.p 246 REVCTDE 252
                          **98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.5E-52155251IPR009072Histone-fold
SuperFamilySSF471136.21E-39159252IPR009072Histone-fold
PfamPF008085.5E-28162226IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.3E-22190208No hitNo description
PROSITE patternPS006850193209IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.3E-22209227No hitNo description
PRINTSPR006153.3E-22228246No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MLTNSEHQIT NYPAPGPRCA GLSHPQPPRG GAPGGLYKPP RTARIPPPPH RTRPGGLLFS  60
SVRSPTRRPH RSSLRFPTSA FPARARARHL ALPSFHVAPA RAYIRVSAGW PARGGGGPAA  120
VREERMADAP ASPGGGGGSH ESGSPKGGGG GGGGGVREQD RFLPIANISR IMKKAIPANG  180
KIAKDAKETV QECVSEFISF ITSEASDKCQ REKRKTINGD DLLWAMATLG FEDYIEPLKV  240
YLQKYREVCT DESVRVNRIS ICVGIIKDDL YLAKLAGGHR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-48157247393NF-YB
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.97100.0callus| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0410971e-151BT041097.1 Zea mays full-length cDNA clone ZM_BFc0174L17 mRNA, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.16e-61nuclear factor Y, subunit B3